PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_30708
Common NameKK1_033347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family WRKY
Protein Properties Length: 137aa    MW: 16184.4 Da    PI: 10.053
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_30708genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.73.1e-3057115159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYG K+vk+++fprsYYrC+++gC+vkk+++r  +d+++v++tYeg H h+
  C.cajan_30708  57 LDDGYRWRKYGEKSVKNNKFPRSYYRCSYRGCTVKKQIQRHWKDQEIVVTTYEGIHIHP 115
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.6E-3144115IPR003657WRKY domain
SuperFamilySSF1182901.09E-2749116IPR003657WRKY domain
PROSITE profilePS5081128.40352117IPR003657WRKY domain
SMARTSM007741.4E-3457116IPR003657WRKY domain
PfamPF031062.5E-2458115IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MEKVLFPISS SSSDLKLGDH IHNSNVHVKK ASWPSQKGGK EISHKYAFQT RSQVDILDDG  60
YRWRKYGEKS VKNNKFPRSY YRCSYRGCTV KKQIQRHWKD QEIVVTTYEG IHIHPVEKSP  120
ESFEQILRNF QIYHLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2647114774Probable WRKY transcription factor 4
2lex_A7e-2647114774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0195671e-102EU019567.1 Glycine max WRKY25 (WRKY25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237010.13e-66WRKY25 protein
SwissprotQ9FYA24e-49WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A151RRH43e-99A0A151RRH4_CAJCA; Putative WRKY transcription factor 75
STRINGGLYMA08G01430.13e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-50WRKY DNA-binding protein 75